TMEM126B Antikörper (Middle Region)

Produktnummer ABIN630389

Produktdetails anti-TMEM126B Antikörper

Target: TMEM126B (Transmembrane Protein 126B (TMEM126B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM126B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM126 B antibody was raised against the middle region of TMEM126

Aufreinigung: Purified

Immunogen: TMEM126 B antibody was raised using the middle region of TMEM126 corresponding to a region with amino acids VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM126B Blocking Peptide, catalog no. 33R-9538, is also available for use as a blocking control in assays to test for specificity of this TMEM126B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM120 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM126B

Target: TMEM126B (Transmembrane Protein 126B (TMEM126B))

Andere Bezeichnung: TMEM126B (TMEM126B Produkte)

Synonyme: 1110001A23Rik antikoerper, RGD1308371 antikoerper, transmembrane protein 126B antikoerper, TMEM126B antikoerper, Tmem126b antikoerper

Hintergrund: The function of TMEM126B protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 23 kDa (MW of target protein)