TOR2A Antikörper (N-Term)

Produktnummer ABIN630394

Produktdetails anti-TOR2A Antikörper

Target: TOR2A (Torsin Family 2, Member A (TOR2A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TOR2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TOR2 A antibody was raised against the N terminal of TOR2

Aufreinigung: Purified

Immunogen: TOR2 A antibody was raised using the N terminal of TOR2 corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TOR2A Blocking Peptide, catalog no. 33R-3388, is also available for use as a blocking control in assays to test for specificity of this TOR2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TOR2A

Target: TOR2A (Torsin Family 2, Member A (TOR2A))

Andere Bezeichnung: TOR2A (TOR2A Produkte)

Synonyme: tor2a antikoerper, TOR2A antikoerper, zgc:114110 antikoerper, TORP1 antikoerper, Prosalusin antikoerper, Torsin-2A antikoerper, torsin family 2 member A antikoerper, torsin family 2, member A L homeolog antikoerper, torsin family 2, member A antikoerper, TOR2A antikoerper, tor2a.L antikoerper, tor2a antikoerper, Tor2a antikoerper

Hintergrund: The function of TOR2A protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 36 kDa (MW of target protein)