SLC13A3 Antikörper

Produktnummer ABIN630395

Produktdetails anti-SLC13A3 Antikörper

Target: SLC13A3 (Solute Carrier Family 13 Member 3 (SLC13A3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC13A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SLC13 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC13A3 Blocking Peptide, catalog no. 33R-3423, is also available for use as a blocking control in assays to test for specificity of this SLC13A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC13A3

Target: SLC13A3 (Solute Carrier Family 13 Member 3 (SLC13A3))

Andere Bezeichnung: SLC13A3 (SLC13A3 Produkte)

Synonyme: MGC108337 antikoerper, SLC13A3 antikoerper, zgc:77173 antikoerper, nadc3 antikoerper, sdct2 antikoerper, NADC3 antikoerper, SDCT2 antikoerper, NaDC-3 antikoerper, NaDC3 antikoerper, Nadc3 antikoerper, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 antikoerper, solute carrier family 13 member 3 antikoerper, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 L homeolog antikoerper, slc13a3 antikoerper, SLC13A3 antikoerper, slc13a3.L antikoerper, Slc13a3 antikoerper

Hintergrund: Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport