MOSPD3 Antikörper (C-Term)

Produktnummer ABIN630396

Produktdetails anti-MOSPD3 Antikörper

Target: MOSPD3 (Motile Sperm Domain Containing 3 (MOSPD3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MOSPD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: MOSPD3 antibody was raised against the C terminal of MOSPD3

Aufreinigung: Purified

Immunogen: MOSPD3 antibody was raised using the C terminal of MOSPD3 corresponding to a region with amino acids FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MOSPD3 Blocking Peptide, catalog no. 33R-2967, is also available for use as a blocking control in assays to test for specificity of this MOSPD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOSPD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MOSPD3

Target: MOSPD3 (Motile Sperm Domain Containing 3 (MOSPD3))

Andere Bezeichnung: MOSPD3 (MOSPD3 Produkte)

Synonyme: CDS3 antikoerper, NET30 antikoerper, 1190005J19Rik antikoerper, 5133401H10Rik antikoerper, Gtig2 antikoerper, R124 antikoerper, cds3 antikoerper, MGC89012 antikoerper, MOSPD3 antikoerper, motile sperm domain containing 3 antikoerper, motile sperm domain containing 3 L homeolog antikoerper, MOSPD3 antikoerper, Mospd3 antikoerper, mospd3 antikoerper, mospd3.L antikoerper

Hintergrund: MOSPD3 is a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality.

Molekulargewicht: 24 kDa (MW of target protein)