UST Antikörper (C-Term)

Produktnummer ABIN630398

Produktdetails anti-UST Antikörper

Target: UST (Uronyl-2-Sulfotransferase (UST))

Bindungsspezifität: C-Term

Reaktivität: Human, Hund, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UST Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: UST antibody was raised against the C terminal of UST

Aufreinigung: Purified

Immunogen: UST antibody was raised using the C terminal of UST corresponding to a region with amino acids YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UST Blocking Peptide, catalog no. 33R-10095, is also available for use as a blocking control in assays to test for specificity of this UST antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UST antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UST

Target: UST (Uronyl-2-Sulfotransferase (UST))

Andere Bezeichnung: UST (UST Produkte)

Synonyme: si:dkey-185l3.2 antikoerper, 2OST antikoerper, D930010O20Rik antikoerper, UA2OST antikoerper, uronyl 2-sulfotransferase antikoerper, uronyl-2-sulfotransferase antikoerper, UST antikoerper, ust antikoerper, Ust antikoerper

Hintergrund: UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process