FAM55D Antikörper (C-Term)

Produktnummer ABIN630400

Produktdetails anti-FAM55D Antikörper

Target: FAM55D (Family with Sequence Similarity 55, Member D (FAM55D))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM55D Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: FAM55 D antibody was raised against the C terminal of FAM55

Aufreinigung: Purified

Immunogen: FAM55 D antibody was raised using the C terminal of FAM55 corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM55D Blocking Peptide, catalog no. 33R-9404, is also available for use as a blocking control in assays to test for specificity of this FAM55D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM55D

Target: FAM55D (Family with Sequence Similarity 55, Member D (FAM55D))

Andere Bezeichnung: FAM55D (FAM55D Produkte)

Synonyme: Fam55d antikoerper, Nxpe4 antikoerper, C11orf33 antikoerper, FAM55D antikoerper, C130036J11 antikoerper, D930028F11Rik antikoerper, neurexophilin and PC-esterase domain family member 4 antikoerper, neurexophilin and PC-esterase domain family, member 4 antikoerper, Nxpe4 antikoerper, NXPE4 antikoerper

Hintergrund: The function of FAM55 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 60 kDa (MW of target protein)