FAR1 Antikörper (N-Term)
-
- Target Alle FAR1 Antikörper anzeigen
- FAR1 (Fatty Acyl CoA Reductase 1 (FAR1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MLSTD2 antibody was raised against the N terminal Of Mlstd2
- Aufreinigung
- Purified
- Immunogen
- MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
- Top Product
- Discover our top product FAR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MLSTD2 Blocking Peptide, catalog no. 33R-5390, is also available for use as a blocking control in assays to test for specificity of this MLSTD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAR1 (Fatty Acyl CoA Reductase 1 (FAR1))
- Andere Bezeichnung
- MLSTD2 (FAR1 Produkte)
- Synonyme
- MLSTD2 antikoerper, SDR10E1 antikoerper, 2600011M19Rik antikoerper, 2900034E22Rik antikoerper, 3732409C05Rik antikoerper, AI850429 antikoerper, Mlstd2 antikoerper, mlstd2 antikoerper, MQJ16.4 antikoerper, MQJ16_4 antikoerper, fatty acid reductase 1 antikoerper, fatty acyl-CoA reductase 1 antikoerper, fatty acyl CoA reductase 1 antikoerper, fatty acyl-CoA reductase 1 L homeolog antikoerper, fatty acid reductase 1 antikoerper, FAR1 antikoerper, Far1 antikoerper, far1.L antikoerper
- Hintergrund
- MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.
- Molekulargewicht
- 59 kDa (MW of target protein)
-