CDH22 Antikörper (N-Term)
-
- Target Alle CDH22 Antikörper anzeigen
- CDH22 (Cadherin-Like 22 (CDH22))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDH22 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDH22 antibody was raised against the N terminal of CDH22
- Aufreinigung
- Purified
- Immunogen
- CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD
- Top Product
- Discover our top product CDH22 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDH22 Blocking Peptide, catalog no. 33R-5040, is also available for use as a blocking control in assays to test for specificity of this CDH22 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH22 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDH22 (Cadherin-Like 22 (CDH22))
- Andere Bezeichnung
- CDH22 (CDH22 Produkte)
- Hintergrund
- CDH22 is a member of the cadherin superfamily. CDH22 is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins.
- Molekulargewicht
- 73 kDa (MW of target protein)
-