Aspartate beta Hydroxylase Antikörper (N-Term)
-
- Target Alle Aspartate beta Hydroxylase (ASPH) Antikörper anzeigen
- Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Aspartate beta Hydroxylase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ASPH antibody was raised against the N terminal of ASPH
- Aufreinigung
- Purified
- Immunogen
- ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE
- Top Product
- Discover our top product ASPH Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ASPH Blocking Peptide, catalog no. 33R-8411, is also available for use as a blocking control in assays to test for specificity of this ASPH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))
- Andere Bezeichnung
- ASPH (ASPH Produkte)
- Synonyme
- AAH antikoerper, BAH antikoerper, CASQ2BP1 antikoerper, HAAH antikoerper, JCTN antikoerper, junctin antikoerper, 2310005F16Rik antikoerper, 3110001L23Rik antikoerper, AI848629 antikoerper, AW261690 antikoerper, AW561901 antikoerper, C79816 antikoerper, cI-37 antikoerper, aah antikoerper, bah antikoerper, jctn antikoerper, MGC107896 antikoerper, cb971 antikoerper, fb69e10 antikoerper, fc06d04 antikoerper, fc95a08 antikoerper, wu:fb69e10 antikoerper, wu:fc06d04 antikoerper, wu:fc95a08 antikoerper, aspartate beta-hydroxylase antikoerper, aspartate-beta-hydroxylase antikoerper, aspartate beta-hydroxylase L homeolog antikoerper, ASPH antikoerper, Asph antikoerper, asph antikoerper, asph.L antikoerper
- Hintergrund
- ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-