GPR161 Antikörper (N-Term)
-
- Target Alle GPR161 Antikörper anzeigen
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPR161 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- GPR161 antibody was raised against the N terminal of GPR161
- Aufreinigung
- Purified
- Immunogen
- GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV
- Top Product
- Discover our top product GPR161 Primärantikörper
-
anti-G Protein-Coupled Receptor 161 (GPR161) (Cytoplasmic Domain) antibody
GPR161 Reaktivität: Human, Affe, Hamster IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (Middle Region) antibodyGPR161 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Rind (Kuh), Hund, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (AA 1-28) antibodyGPR161 Reaktivität: Human WB, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) antibodyGPR161 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (AA 362-460) antibodyGPR161 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1B2 unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (C-Term) antibodyGPR161 Reaktivität: Human, Rind (Kuh), Hund, Pferd, Kaninchen, Schwein, Affe IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (C-Term) antibodyGPR161 Reaktivität: Human, Maus, Meerschweinchen, Rind (Kuh), Hund, Pferd, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (N-Term) antibodyGPR161 Reaktivität: Human, Maus, Meerschweinchen, Schwein, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (AA 201-250) antibodyGPR161 Reaktivität: Human, Maus, Rind (Kuh), Schwein, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-G Protein-Coupled Receptor 161 (GPR161) (C-Term) antibodyGPR161 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPR161 Blocking Peptide, catalog no. 33R-6464, is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
- Andere Bezeichnung
- GPR161 (GPR161 Produkte)
- Synonyme
- RE2 antikoerper, Gm208 antikoerper, Gm208Gpr antikoerper, vl antikoerper, RGD1563245 antikoerper, si:bz20i5.4 antikoerper, si:rp71-20i5.4 antikoerper, G protein-coupled receptor 161 antikoerper, GPR161 antikoerper, Gpr161 antikoerper, gpr161 antikoerper
- Hintergrund
- GPR161 is orphan receptor.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-
