SLC35B1 Antikörper (C-Term)

Produktnummer ABIN630422

Produktdetails anti-SLC35B1 Antikörper

Target: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC35 B1 antibody was raised against the C terminal of SLC35 1

Aufreinigung: Purified

Immunogen: SLC35 B1 antibody was raised using the C terminal of SLC35 1 corresponding to a region with amino acids ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35B1 Blocking Peptide, catalog no. 33R-1334, is also available for use as a blocking control in assays to test for specificity of this SLC35B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35B1

Target: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Andere Bezeichnung: SLC35B1 (SLC35B1 Produkte)

Synonyme: UGTREL1 antikoerper, Ugalt2 antikoerper, UGTrel1 antikoerper, ERNST antikoerper, UGALT2 antikoerper, ernst1 antikoerper, ERNST1 antikoerper, wu:fj99g11 antikoerper, zgc:92284 antikoerper, solute carrier family 35 member B1 antikoerper, solute carrier family 35, member B1 antikoerper, solute carrier family 35 member B1 L homeolog antikoerper, SLC35B1 antikoerper, Slc35b1 antikoerper, slc35b1 antikoerper, slc35b1.L antikoerper

Hintergrund: SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.

Molekulargewicht: 35 kDa (MW of target protein)