SDF4 Antikörper (C-Term)

Produktnummer ABIN630423

Produktdetails anti-SDF4 Antikörper

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SDF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SDF4 antibody was raised against the C terminal of SDF4

Aufreinigung: Purified

Immunogen: SDF4 antibody was raised using the C terminal of SDF4 corresponding to a region with amino acids KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SDF4 Blocking Peptide, catalog no. 33R-4609, is also available for use as a blocking control in assays to test for specificity of this SDF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SDF4

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Andere Bezeichnung: SDF4 (SDF4 Produkte)

Synonyme: Cab45 antikoerper, SDF-4 antikoerper, MGC107861 antikoerper, wu:fb66d06 antikoerper, wu:fd46e11 antikoerper, zgc:56577 antikoerper, zgc:76916 antikoerper, CAB45 antikoerper, stromal cell derived factor 4 antikoerper, stromal cell derived factor 4 L homeolog antikoerper, SDF4 antikoerper, sdf4 antikoerper, sdf4.L antikoerper, Sdf4 antikoerper

Hintergrund: SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Molekulargewicht: 39 kDa (MW of target protein)