ADAM30 Antikörper (N-Term)

Produktnummer ABIN630427

Produktdetails anti-ADAM30 Antikörper

Target: ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ADAM30 antibody was raised against the N terminal of ADAM30

Aufreinigung: Purified

Immunogen: ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAM30 Blocking Peptide, catalog no. 33R-8040, is also available for use as a blocking control in assays to test for specificity of this ADAM30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAM30

Target: ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))

Andere Bezeichnung: ADAM30 (ADAM30 Produkte)

Synonyme: svph4 antikoerper, 4933424D07Rik antikoerper, ADAM metallopeptidase domain 30 antikoerper, a disintegrin and metallopeptidase domain 30 antikoerper, ADAM30 antikoerper, Adam30 antikoerper

Hintergrund: ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM30 gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats.

Molekulargewicht: 66 kDa (MW of target protein)