MGAT2 Antikörper

Produktnummer ABIN630430

Produktdetails anti-MGAT2 Antikörper

Target: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MGAT2 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Aufreinigung: Purified

Immunogen: MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGAT2 Blocking Peptide, catalog no. 33R-7174, is also available for use as a blocking control in assays to test for specificity of this MGAT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGAT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MGAT2

Target: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Andere Bezeichnung: MGAT2 (MGAT2 Produkte)

Synonyme: CDG2A antikoerper, CDGS2 antikoerper, GLCNACTII antikoerper, GNT-II antikoerper, GNT2 antikoerper, CG7921 antikoerper, Dmel\\CG7921 antikoerper, GlcNAc-TII antikoerper, GlcNAcT2 antikoerper, dMGAT2 antikoerper, MGC89475 antikoerper, Gnt2 antikoerper, AA407964 antikoerper, CH73-301C19.1 antikoerper, zgc:162268 antikoerper, mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase antikoerper, CG7921 gene product from transcript CG7921-RB antikoerper, mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase L homeolog antikoerper, mannoside acetylglucosaminyltransferase 2 antikoerper, MGAT2 antikoerper, Mgat2 antikoerper, mgat2.L antikoerper, mgat2 antikoerper

Hintergrund: MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II.

Molekulargewicht: 51 kDa (MW of target protein)