LRPAP1 Antikörper (C-Term)

Produktnummer ABIN630434

Produktdetails anti-LRPAP1 Antikörper

Target: LRPAP1 (Low Density Lipoprotein Receptor-Related Protein Associated Protein 1 (LRPAP1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRPAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: LRPAP1 antibody was raised against the C terminal of LRPAP1

Aufreinigung: Purified

Immunogen: LRPAP1 antibody was raised using the C terminal of LRPAP1 corresponding to a region with amino acids IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRPAP1 Blocking Peptide, catalog no. 33R-3922, is also available for use as a blocking control in assays to test for specificity of this LRPAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRPAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRPAP1

Target: LRPAP1 (Low Density Lipoprotein Receptor-Related Protein Associated Protein 1 (LRPAP1))

Andere Bezeichnung: LRPAP1 (LRPAP1 Produkte)

Synonyme: wu:fi20f07 antikoerper, wu:fi22c06 antikoerper, LRPAP1 antikoerper, DKFZp459I2430 antikoerper, A2MRAP antikoerper, A2RAP antikoerper, HBP44 antikoerper, MRAP antikoerper, RAP antikoerper, AA617339 antikoerper, AI790446 antikoerper, AU042172 antikoerper, C77774 antikoerper, alpha-2-macroglobulin receptor-associated protein-like antikoerper, low density lipoprotein receptor-related protein associated protein 1 antikoerper, LDL receptor related protein associated protein 1 antikoerper, LDL receptor related protein associated protein 1 L homeolog antikoerper, LOC100231803 antikoerper, lrpap1 antikoerper, LRPAP1 antikoerper, Lrpap1 antikoerper, lrpap1.L antikoerper

Hintergrund: LRPAP1 interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.

Molekulargewicht: 39 kDa (MW of target protein)