UGT3A2 Antikörper (N-Term)

Produktnummer ABIN630444

Produktdetails anti-UGT3A2 Antikörper

Target: UGT3A2 (UDP Glycosyltransferase 3 Family, Polypeptide A2 (UGT3A2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT3A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT3 A2 antibody was raised against the N terminal of µgT3 2

Aufreinigung: Purified

Immunogen: UGT3 A2 antibody was raised using the N terminal of µgT3 2 corresponding to a region with amino acids HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT3A2 Blocking Peptide, catalog no. 33R-3804, is also available for use as a blocking control in assays to test for specificity of this µgT3A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT3A2

Target: UGT3A2 (UDP Glycosyltransferase 3 Family, Polypeptide A2 (UGT3A2))

Andere Bezeichnung: UGT3A2 (UGT3A2 Produkte)

Synonyme: AI313915 antikoerper, UDPGT 3A1 antikoerper, ugt3a1 antikoerper, ugt3a2 antikoerper, UDP glycosyltransferase family 3 member A2 antikoerper, UDP glycosyltransferases 3 family, polypeptide A2 antikoerper, UDP glycosyltransferase 3 family, polypeptide A2 L homeolog antikoerper, UGT3A2 antikoerper, Ugt3a2 antikoerper, ugt3a2.L antikoerper

Hintergrund: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Molekulargewicht: 59 kDa (MW of target protein)