NPTN Antikörper (Middle Region)
-
- Target Alle NPTN Antikörper anzeigen
- NPTN (Neuroplastin (NPTN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NPTN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Neuroplastin antibody was raised against the middle region of NPTN
- Aufreinigung
- Purified
- Immunogen
- Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN
- Top Product
- Discover our top product NPTN Primärantikörper
-
anti-Neuroplastin (NPTN) antibody
NPTN Reaktivität: Human, Ratte, Hund, Affe WB, IHC, IF, IHC (p) Wirt: Maus Monoclonal 3C4 unconjugated
anti-Neuroplastin (NPTN) (Internal Region) antibodyNPTN Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Affe, Rind (Kuh), Meerschweinchen, Pferd, Schwein, Fledermaus, Hamster IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Neuroplastin (NPTN) (N-Term) antibodyNPTN Reaktivität: Human, Kaninchen, Affe IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Neuroplastin (NPTN) (AA 29-200) antibodyNPTN Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Neuroplastin (NPTN) (AA 201-250) antibodyNPTN Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Affe, Rind (Kuh), Meerschweinchen, Pferd, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Neuroplastin (NPTN) (AA 194-210), (Extracellular), (N-Term) antibodyNPTN Reaktivität: Human, Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Neuroplastin (NPTN) (AA 51-150) antibodyNPTN Reaktivität: Human WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Neuroplastin (NPTN) (AA 188-216), (N-Term) antibodyNPTN Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB32612 unconjugated
anti-Neuroplastin (NPTN) antibodyNPTN Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Neuroplastin (NPTN) (AA 108-157) antibodyNPTN Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Affe, Rind (Kuh), Meerschweinchen, Pferd, Schwein, Zebrafisch (Danio rerio), Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Neuroplastin Blocking Peptide, catalog no. 33R-5985, is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPTN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NPTN (Neuroplastin (NPTN))
- Andere Bezeichnung
- Neuroplastin (NPTN Produkte)
- Synonyme
- SDFR1 antikoerper, GP55 antikoerper, GP65 antikoerper, SDR1 antikoerper, np55 antikoerper, np65 antikoerper, AW554172 antikoerper, Sdfr1 antikoerper, nptn antikoerper, zgc:77326 antikoerper, neuroplastin antikoerper, neuroplastin L homeolog antikoerper, neuroplastin b antikoerper, NPTN antikoerper, Nptn antikoerper, nptn.L antikoerper, nptnb antikoerper
- Hintergrund
- Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Regulation of long-term Neuronal Synaptic Plasticity
-
