LMAN1 Antikörper (Middle Region)
-
- Target Alle LMAN1 Antikörper anzeigen
- LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LMAN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LMAN1 antibody was raised against the middle region of LMAN1
- Aufreinigung
- Purified
- Immunogen
- LMAN1 antibody was raised using the middle region of LMAN1 corresponding to a region with amino acids DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR
- Top Product
- Discover our top product LMAN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LMAN1 Blocking Peptide, catalog no. 33R-2022, is also available for use as a blocking control in assays to test for specificity of this LMAN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))
- Andere Bezeichnung
- LMAN1 (LMAN1 Produkte)
- Hintergrund
- LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.
- Molekulargewicht
- 54 kDa (MW of target protein)
-