LMAN1 Antikörper (Middle Region)

Produktnummer ABIN630450

Produktdetails anti-LMAN1 Antikörper

Target: LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LMAN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LMAN1 antibody was raised against the middle region of LMAN1

Aufreinigung: Purified

Immunogen: LMAN1 antibody was raised using the middle region of LMAN1 corresponding to a region with amino acids DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LMAN1 Blocking Peptide, catalog no. 33R-2022, is also available for use as a blocking control in assays to test for specificity of this LMAN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LMAN1

Target: LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))

Andere Bezeichnung: LMAN1 (LMAN1 Produkte)

Synonyme: ERGIC-53 antikoerper, ERGIC53 antikoerper, F5F8D antikoerper, FMFD1 antikoerper, MCFD1 antikoerper, MR60 antikoerper, gp58 antikoerper, 2610020P13Rik antikoerper, AI326273 antikoerper, AU043785 antikoerper, C730041J05 antikoerper, P58 antikoerper, p58 antikoerper, LMAN1 antikoerper, cpx-iii antikoerper, cpxiii antikoerper, lman1 antikoerper, wu:fc54c09 antikoerper, wu:fi36e01 antikoerper, Xp58 antikoerper, lman1-a antikoerper, lectin, mannose binding 1 antikoerper, lectin, mannose-binding, 1 antikoerper, complexin 3 antikoerper, lectin, mannose binding 1 S homeolog antikoerper, LMAN1 antikoerper, Lman1 antikoerper, cplx3 antikoerper, lman1 antikoerper, lman1.S antikoerper

Hintergrund: LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.

Molekulargewicht: 54 kDa (MW of target protein)