ST3GAL5 Antikörper (N-Term)

Produktnummer ABIN630451

Produktdetails anti-ST3GAL5 Antikörper

Target: ST3GAL5 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 5 (ST3GAL5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST3GAL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ST3 GAL5 antibody was raised against the N terminal of ST3 AL5

Aufreinigung: Purified

Immunogen: ST3 GAL5 antibody was raised using the N terminal of ST3 AL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST3GAL5 Blocking Peptide, catalog no. 33R-2160, is also available for use as a blocking control in assays to test for specificity of this ST3GAL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST3GAL5

Target: ST3GAL5 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 5 (ST3GAL5))

Andere Bezeichnung: ST3GAL5 (ST3GAL5 Produkte)

Synonyme: SATI antikoerper, SIAT9 antikoerper, SIATGM3S antikoerper, ST3GalV antikoerper, ST3GAL-V antikoerper, 3S-T antikoerper, Siat9 antikoerper, [a]2 antikoerper, ST3 beta-galactoside alpha-2,3-sialyltransferase 5 antikoerper, ST3GAL5 antikoerper, St3gal5 antikoerper

Hintergrund: Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.

Molekulargewicht: 48 kDa (MW of target protein)