PIGV Antikörper (N-Term)

Produktnummer ABIN630452

Produktdetails anti-PIGV Antikörper

Target: PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIGV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PIGV antibody was raised against the N terminal of PIGV

Aufreinigung: Purified

Immunogen: PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGV Blocking Peptide, catalog no. 33R-3111, is also available for use as a blocking control in assays to test for specificity of this PIGV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGV antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIGV

Target: PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))

Andere Bezeichnung: PIGV (PIGV Produkte)

Synonyme: GPI-MT-II antikoerper, HPMRS1 antikoerper, PIG-V antikoerper, B330013B03 antikoerper, D430024F16Rik antikoerper, RGD1309526 antikoerper, phosphatidylinositol glycan anchor biosynthesis class V antikoerper, zinc finger DHHC-type containing 18 antikoerper, phosphatidylinositol glycan anchor biosynthesis, class V antikoerper, PIGV antikoerper, ZDHHC18 antikoerper, Pigv antikoerper

Hintergrund: Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Inositol Metabolic Process