SSR2 Antikörper
-
- Target Alle SSR2 Antikörper anzeigen
- SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SSR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAA
- Top Product
- Discover our top product SSR2 Primärantikörper
-
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (AA 1-186) antibody
SSR2 Reaktivität: Human WB, FACS Wirt: Maus Polyclonal unconjugated
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) antibodySSR2 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (AA 51-150) antibodySSR2 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 4C1 unconjugated
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (AA 154-183), (C-Term) antibodySSR2 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB32740 unconjugated
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (N-Term) antibodySSR2 Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Rind (Kuh), Meerschweinchen, Pferd, Fledermaus, Hamster, Affe, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (N-Term) antibodySSR2 Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Rind (Kuh), Meerschweinchen, Pferd WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (AA 18-149) antibodySSR2 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (AA 99-148) antibodySSR2 Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Fledermaus, Hamster, Affe, Schwein, Huhn, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) (C-Term) antibodySSR2 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SSR2 Blocking Peptide, catalog no. 33R-8444, is also available for use as a blocking control in assays to test for specificity of this SSR2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))
- Andere Bezeichnung
- SSR2 (SSR2 Produkte)
- Hintergrund
- The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein (alpha-SSR or SSR1) and a 22 kDa glycoprotein (beta-SSR or SSR2).
- Molekulargewicht
- 20 kDa (MW of target protein)
-
