SULF2 Antikörper (C-Term)
-
- Target Alle SULF2 Antikörper anzeigen
- SULF2 (Sulfatase 2 (SULF2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SULF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SULF2 antibody was raised against the C terminal of SULF2
- Aufreinigung
- Purified
- Immunogen
- SULF2 antibody was raised using the C terminal of SULF2 corresponding to a region with amino acids DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW
- Top Product
- Discover our top product SULF2 Primärantikörper
-
anti-Sulfatase 2 (SULF2) (AA 337-654) antibody
SULF2 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 463-660) antibodySULF2 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 337-649) antibodySULF2 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (C-Term) antibodySULF2 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Pferd, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 651-750) antibodySULF2 Reaktivität: Ratte WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 801-850) antibodySULF2 Reaktivität: Human, Kaninchen, Rind (Kuh), Hund, Pferd, Affe, Fledermaus, Hamster WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 824-852), (C-Term) antibodySULF2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB31333 unconjugated
anti-Sulfatase 2 (SULF2) (AA 1-149) antibodySULF2 Reaktivität: Human ELISA Wirt: Maus Monoclonal 2H5 unconjugated
anti-Sulfatase 2 (SULF2) (Internal Region) antibodyVerified SULF2 Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Sulfatase 2 (SULF2) (AA 831-860), (C-Term) antibodySULF2 Reaktivität: Human, Maus WB, EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SULF2 Blocking Peptide, catalog no. 33R-2218, is also available for use as a blocking control in assays to test for specificity of this SULF2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULF2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULF2 (Sulfatase 2 (SULF2))
- Andere Bezeichnung
- SULF2 (SULF2 Produkte)
- Synonyme
- Sulf1 antikoerper, zgc:55612 antikoerper, SULF2 antikoerper, si:dkeyp-84g9.1 antikoerper, wu:fb48e04 antikoerper, HSULF-2 antikoerper, xtsulf2 antikoerper, 2010004N24Rik antikoerper, AU020235 antikoerper, MSulf-2 antikoerper, mKIAA1247 antikoerper, sulfatase 2a antikoerper, sulfatase 2 antikoerper, extracellular sulfatase Sulf-2 antikoerper, sulfatase 2b antikoerper, sulfatase 2 S homeolog antikoerper, sulf2a antikoerper, SULF2 antikoerper, LOC100540921 antikoerper, sulf2 antikoerper, sulf2b antikoerper, sulf2.S antikoerper, Sulf2 antikoerper
- Hintergrund
- Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.
- Molekulargewicht
- 98 kDa (MW of target protein)
-
