TM9SF1 Antikörper (N-Term)
-
- Target Alle TM9SF1 Antikörper anzeigen
- TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TM9SF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- TM9 SF1 antibody was raised against the N terminal of TM9 F1
- Aufreinigung
- Purified
- Immunogen
- TM9 SF1 antibody was raised using the N terminal of TM9 F1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG
- Top Product
- Discover our top product TM9SF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TM9SF1 Blocking Peptide, catalog no. 33R-2450, is also available for use as a blocking control in assays to test for specificity of this TM9SF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))
- Andere Bezeichnung
- TM9SF1 (TM9SF1 Produkte)
- Synonyme
- TM9SF1 antikoerper, fa03b09 antikoerper, wu:fa03b09 antikoerper, zgc:100810 antikoerper, HMP70 antikoerper, MP70 antikoerper, 1200014D02Rik antikoerper, AI893436 antikoerper, transmembrane 9 superfamily member 1 antikoerper, transmembrane 9 superfamily member 1 L homeolog antikoerper, TM9SF1 antikoerper, tm9sf1 antikoerper, tm9sf1.L antikoerper, Tm9sf1 antikoerper
- Hintergrund
- TM9SF1 may function as channel, small molecule transporter or receptor.
- Molekulargewicht
- 67 kDa (MW of target protein)
-