M6PR Antikörper
-
- Target Alle M6PR Antikörper anzeigen
- M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser M6PR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- M6 PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
- Top Product
- Discover our top product M6PR Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
M6PR Blocking Peptide, catalog no. 33R-8035, is also available for use as a blocking control in assays to test for specificity of this M6PR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of M0 R antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))
- Andere Bezeichnung
- M6PR (M6PR Produkte)
- Synonyme
- CD222 antikoerper, CIMPR antikoerper, M6P-R antikoerper, MPR1 antikoerper, MPRI antikoerper, CD-MPR antikoerper, MPR 46 antikoerper, MPR-46 antikoerper, MPR46 antikoerper, SMPR antikoerper, Mpr46 antikoerper, CDMPR antikoerper, m6pr antikoerper, MGC68896 antikoerper, MGC130765 antikoerper, zgc:77757 antikoerper, wu:fj81h11 antikoerper, MGC89423 antikoerper, M6PR antikoerper, mprd antikoerper, C16orf27 antikoerper, GNPTAG antikoerper, LP2537 antikoerper, RJD9 antikoerper, insulin like growth factor 2 receptor antikoerper, mannose-6-phosphate receptor, cation dependent antikoerper, mannose-6-phosphate receptor (cation dependent) L homeolog antikoerper, mannose-6-phosphate receptor (cation dependent) antikoerper, mannose-6-phosphate receptor (cation dependent) S homeolog antikoerper, Cation-dependent mannose-6-phosphate receptor antikoerper, N-acetylglucosamine-1-phosphate transferase gamma subunit antikoerper, IGF2R antikoerper, M6PR antikoerper, M6pr antikoerper, m6pr.L antikoerper, m6pr antikoerper, m6pr.S antikoerper, Ethha_1678 antikoerper, mprd antikoerper, GNPTG antikoerper
- Hintergrund
- M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.
- Molekulargewicht
- 28 kDa (MW of target protein)
-