Butyrylcholinesterase Antikörper (N-Term)
-
- Target Alle Butyrylcholinesterase (BCHE) Antikörper anzeigen
- Butyrylcholinesterase (BCHE)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Butyrylcholinesterase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- BCHE antibody was raised against the N terminal of BCHE
- Aufreinigung
- Purified
- Immunogen
- BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
- Top Product
- Discover our top product BCHE Primärantikörper
-
anti-Butyrylcholinesterase (BCHE) (AA 29-150) antibody
BCHE Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) antibodyBCHE Reaktivität: Human, Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) antibodyBCHE Reaktivität: Human, Hund WB, FACS Wirt: Maus Monoclonal 1E1 unconjugated
anti-Butyrylcholinesterase (BCHE) (AA 311-524) antibodyBCHE Reaktivität: Human WB, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) (AA 505-602) antibodyBCHE Reaktivität: Human WB, ELISA, IF (p), IF (cc), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) antibodyBCHE Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) antibodyBCHE Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) (AA 29-270) antibodyBCHE Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) (AA 151-200) antibodyBCHE Reaktivität: Human, Maus, Hund, Schaf, Rind (Kuh), Pferd, Fledermaus, Huhn WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) (N-Term) antibodyBCHE Reaktivität: Human, Maus, Hund, Ratte, Schaf, Rind (Kuh), Pferd, Meerschweinchen, Schwein, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BCHE Blocking Peptide, catalog no. 33R-8821, is also available for use as a blocking control in assays to test for specificity of this BCHE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCHE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Butyrylcholinesterase (BCHE)
- Andere Bezeichnung
- BCHE (BCHE Produkte)
- Synonyme
- che antikoerper, che1 antikoerper, bche antikoerper, cholinesterase antikoerper, CHE1 antikoerper, CHE2 antikoerper, E1 antikoerper, C730038G20Rik antikoerper, butyrylcholinesterase L homeolog antikoerper, butyrylcholinesterase antikoerper, bche.L antikoerper, bche antikoerper, BCHE antikoerper, Bche antikoerper
- Hintergrund
- Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism
-
