PLP2 Antikörper

Produktnummer ABIN630464

Produktdetails anti-PLP2 Antikörper

Target: PLP2 (Proteolipid Protein 2 (PLP2))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PLP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLP2 Blocking Peptide, catalog no. 33R-5507, is also available for use as a blocking control in assays to test for specificity of this PLP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLP2

Target: PLP2 (Proteolipid Protein 2 (PLP2))

Andere Bezeichnung: PLP2 (PLP2 Produkte)

Synonyme: A4 antikoerper, A4LSB antikoerper, mIMA4 antikoerper, A4-LSB antikoerper, a4lsb antikoerper, plp2 antikoerper, proteolipid protein 2 antikoerper, proteolipid protein 2 S homeolog antikoerper, PLP2 antikoerper, Plp2 antikoerper, plp2.S antikoerper

Hintergrund: PLP2 may play a role in cell differentiation in the intestinal epithelium.

Molekulargewicht: 17 kDa (MW of target protein)