CHST1 Antikörper
-
- Target Alle CHST1 Antikörper anzeigen
- CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHST1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHST1 Blocking Peptide, catalog no. 33R-8443, is also available for use as a blocking control in assays to test for specificity of this CHST1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))
- Andere Bezeichnung
- CHST1 (CHST1 Produkte)
- Synonyme
- C6ST antikoerper, GST-1 antikoerper, KS6ST antikoerper, KSGal6ST antikoerper, KSST antikoerper, sulfo1 antikoerper, 2610008E20Rik antikoerper, AW125896 antikoerper, Gst1 antikoerper, KSGAL6ST antikoerper, carbohydrate sulfotransferase 1 antikoerper, carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 antikoerper, CHST1 antikoerper, Chst1 antikoerper
- Hintergrund
- CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. It may function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. It participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-