Calmegin Antikörper (N-Term)
-
- Target Alle Calmegin (CLGN) Antikörper anzeigen
- Calmegin (CLGN)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Calmegin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Calmegin antibody was raised against the N terminal of CLGN
- Aufreinigung
- Purified
- Immunogen
- Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL
- Top Product
- Discover our top product CLGN Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Calmegin Blocking Peptide, catalog no. 33R-10157, is also available for use as a blocking control in assays to test for specificity of this Calmegin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLGN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calmegin (CLGN)
- Andere Bezeichnung
- Calmegin (CLGN Produkte)
- Synonyme
- 4930459O04Rik antikoerper, AI528775 antikoerper, Cln antikoerper, canx antikoerper, fj49d10 antikoerper, wu:fj24b04 antikoerper, wu:fj49d10 antikoerper, zgc:153946 antikoerper, CLGN antikoerper, calmegin antikoerper, CLGN antikoerper, Clgn antikoerper, clgn antikoerper
- Hintergrund
- Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneis and infertility.
- Molekulargewicht
- 70 kDa (MW of target protein)
-