Melanoma gp100 Antikörper
-
- Target Alle Melanoma gp100 (PMEL) Antikörper anzeigen
- Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Melanoma gp100 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SILV antibody was raised using a synthetic peptide corresponding to a region with amino acids HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY
- Top Product
- Discover our top product PMEL Primärantikörper
-
anti-Premelanosome Protein (PMEL) antibody
PMEL Reaktivität: Human, Ratte, Hund, Affe IF, IHC, WB, IHC (p) Wirt: Maus Monoclonal 10E5 unconjugated
anti-Premelanosome Protein (PMEL) (AA 376-502) antibodyPMEL Reaktivität: Human IHC, ELISA, StM, Coat Wirt: Maus Monoclonal PMEL-2037 unconjugated
anti-Premelanosome Protein (PMEL) antibodyPMEL Reaktivität: Human IF, IHC, FACS, StM Wirt: Maus Monoclonal HMB45 unconjugated
anti-Premelanosome Protein (PMEL) (C-Term) antibodyVerified PMEL Reaktivität: Human, Maus IF, WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Premelanosome Protein (PMEL) (N-Term) antibodyPMEL Reaktivität: Human, Pferd, Ratte, Maus, Hund, Rind (Kuh), Ziege, Meerschweinchen, Kaninchen IHC, WB Wirt: Kaninchen Polyclonal unconjugated
anti-Premelanosome Protein (PMEL) (AA 25-467) antibodyPMEL Reaktivität: Human IHC, WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Premelanosome Protein (PMEL) antibodyPMEL Reaktivität: Human IHC, StM Wirt: Kaninchen Monoclonal PMEL-1825R unconjugated Recombinant Antibody
anti-Premelanosome Protein (PMEL) (C-Term) antibodyPMEL Reaktivität: Human, Maus IF, IHC, WB, ELISA, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Premelanosome Protein (PMEL) antibodyPMEL Reaktivität: Human IHC Wirt: Kaninchen Monoclonal MSVA-617R unconjugated Recombinant Antibody
anti-Premelanosome Protein (PMEL) (AA 1-661) antibodyPMEL Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SILV Blocking Peptide, catalog no. 33R-3727, is also available for use as a blocking control in assays to test for specificity of this SILV antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SILV antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))
- Andere Bezeichnung
- SILV (PMEL Produkte)
- Hintergrund
- SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.
- Molekulargewicht
- 70 kDa (MW of target protein)
-
