Melanoma gp100 Antikörper

Produktnummer ABIN630469

Produktdetails anti-Melanoma gp100 Antikörper

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Melanoma gp100 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Aufreinigung: Purified

Immunogen: SILV antibody was raised using a synthetic peptide corresponding to a region with amino acids HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SILV Blocking Peptide, catalog no. 33R-3727, is also available for use as a blocking control in assays to test for specificity of this SILV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SILV antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Melanoma gp100

Target: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Andere Bezeichnung: SILV (PMEL Produkte)

Synonyme: D12S53E antikoerper, ME20 antikoerper, ME20-M antikoerper, ME20M antikoerper, P1 antikoerper, P100 antikoerper, PMEL17 antikoerper, SI antikoerper, SIL antikoerper, SILV antikoerper, gp100 antikoerper, D10H12S53E antikoerper, D12S53Eh antikoerper, Pmel17 antikoerper, Si antikoerper, Silv antikoerper, gp87 antikoerper, RPE1 antikoerper, MMP115 antikoerper, silverb antikoerper, silver antikoerper, cb397 antikoerper, fdv antikoerper, pmel17 antikoerper, sb:cb397 antikoerper, silva antikoerper, wu:fc11g11 antikoerper, wu:fj24g11 antikoerper, zgc:136622 antikoerper, premelanosome protein antikoerper, premelanosome protein b antikoerper, premelanosome protein a antikoerper, PMEL antikoerper, Pmel antikoerper, pmelb antikoerper, pmela antikoerper

Hintergrund: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Molekulargewicht: 70 kDa (MW of target protein)