VSIG4 Antikörper (N-Term)
-
- Target Alle VSIG4 Antikörper anzeigen
- VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VSIG4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- VSIG4 antibody was raised against the N terminal of VSIG4
- Aufreinigung
- Purified
- Immunogen
- VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
- Top Product
- Discover our top product VSIG4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VSIG4 Blocking Peptide, catalog no. 33R-9726, is also available for use as a blocking control in assays to test for specificity of this VSIG4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))
- Andere Bezeichnung
- VSIG4 (VSIG4 Produkte)
- Hintergrund
- T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.
- Molekulargewicht
- 44 kDa (MW of target protein)
-