CHST7 Antikörper
-
- Target Alle CHST7 Antikörper anzeigen
- CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))
-
Reaktivität
- Maus, Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHST7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- CHST7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR
- Top Product
- Discover our top product CHST7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHST7 Blocking Peptide, catalog no. 33R-2045, is also available for use as a blocking control in assays to test for specificity of this CHST7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))
- Andere Bezeichnung
- CHST7 (CHST7 Produkte)
- Hintergrund
- CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-