CHST7 Antikörper

Produktnummer ABIN630479

Produktdetails anti-CHST7 Antikörper

Target: CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))

Reaktivität: Maus, Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHST7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: CHST7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHST7 Blocking Peptide, catalog no. 33R-2045, is also available for use as a blocking control in assays to test for specificity of this CHST7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHST7

Target: CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))

Andere Bezeichnung: CHST7 (CHST7 Produkte)

Synonyme: MGC130614 antikoerper, C6ST-2 antikoerper, GST-5 antikoerper, Gn6st-4 antikoerper, 2600013M07Rik antikoerper, GST5 antikoerper, carbohydrate sulfotransferase 7 antikoerper, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7 L homeolog antikoerper, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7 antikoerper, carbohydrate (N-acetylglucosamino) sulfotransferase 7 antikoerper, CHST7 antikoerper, chst7.L antikoerper, chst7 antikoerper, Chst7 antikoerper

Hintergrund: CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process