TMEM178 Antikörper (Middle Region)

Produktnummer ABIN630480

Produktdetails anti-TMEM178 Antikörper

Target: TMEM178 (TMEM178A) (Transmembrane Protein 178A (TMEM178A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM178 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MGC33926 antibody was raised against the middle region of Mgc33926

Aufreinigung: Purified

Immunogen: MGC33926 antibody was raised using the middle region of Mgc33926 corresponding to a region with amino acids RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC33926 Blocking Peptide, catalog no. 33R-8049, is also available for use as a blocking control in assays to test for specificity of this MGC33926 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC33926 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM178

Target: TMEM178 (TMEM178A) (Transmembrane Protein 178A (TMEM178A))

Abstract: TMEM178A Produkte

Synonyme: TMEM178 antikoerper, 2810417M05Rik antikoerper, Tmem178a antikoerper, Tmem178 antikoerper, tmem178 antikoerper, tmem178.1 antikoerper, tmem178a antikoerper, zgc:153181 antikoerper, transmembrane protein 178A antikoerper, transmembrane protein 178 antikoerper, transmembrane protein 178A S homeolog antikoerper, TMEM178A antikoerper, Tmem178 antikoerper, Tmem178a antikoerper, tmem178a.S antikoerper, tmem178 antikoerper

Hintergrund: The function of MGC33926 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 33 kDa (MW of target protein)