TMEM178 Antikörper (Middle Region)
-
- Target Alle TMEM178 (TMEM178A) Antikörper anzeigen
- TMEM178 (TMEM178A) (Transmembrane Protein 178A (TMEM178A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM178 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MGC33926 antibody was raised against the middle region of Mgc33926
- Aufreinigung
- Purified
- Immunogen
- MGC33926 antibody was raised using the middle region of Mgc33926 corresponding to a region with amino acids RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFF
- Top Product
- Discover our top product TMEM178A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MGC33926 Blocking Peptide, catalog no. 33R-8049, is also available for use as a blocking control in assays to test for specificity of this MGC33926 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC33926 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM178 (TMEM178A) (Transmembrane Protein 178A (TMEM178A))
- Abstract
- TMEM178A Produkte
- Hintergrund
- The function of MGC33926 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 33 kDa (MW of target protein)
-