GALNT6 Antikörper (N-Term)

Produktnummer ABIN630481

Produktdetails anti-GALNT6 Antikörper

Target: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALNT6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: GALNT6 antibody was raised against the N terminal of GALNT6

Aufreinigung: Purified

Immunogen: GALNT6 antibody was raised using the N terminal of GALNT6 corresponding to a region with amino acids MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALNT6 Blocking Peptide, catalog no. 33R-6255, is also available for use as a blocking control in assays to test for specificity of this GALNT6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALNT6

Target: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))

Andere Bezeichnung: GALNT6 (GALNT6 Produkte)

Synonyme: 4632410F13 antikoerper, AW047994 antikoerper, GalNAc-T6 antikoerper, fc23d02 antikoerper, fc56f12 antikoerper, wu:fc23d02 antikoerper, wu:fc56f12 antikoerper, zgc:77836 antikoerper, GALNAC-T6 antikoerper, GalNAcT6 antikoerper, galnac-t6 antikoerper, galnact6 antikoerper, polypeptide N-acetylgalactosaminyltransferase 6 antikoerper, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6) antikoerper, GALNT6 antikoerper, Galnt6 antikoerper, galnt6 antikoerper

Hintergrund: GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. GALNT6 is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin.

Molekulargewicht: 71 kDa (MW of target protein)