RHAG Antikörper (Middle Region)
-
- Target Alle RHAG Antikörper anzeigen
- RHAG (Rh Family A Glycoprotein (RHAG))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RHAG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RHAG antibody was raised against the middle region of RHAG
- Aufreinigung
- Purified
- Immunogen
- RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
- Top Product
- Discover our top product RHAG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RHAG Blocking Peptide, catalog no. 33R-2899, is also available for use as a blocking control in assays to test for specificity of this RHAG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHAG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHAG (Rh Family A Glycoprotein (RHAG))
- Andere Bezeichnung
- RHAG (RHAG Produkte)
- Synonyme
- CD241 antikoerper, RH2 antikoerper, RH50A antikoerper, Rh50 antikoerper, Rh50GP antikoerper, SLC42A1 antikoerper, Rh50A antikoerper, Rh-associated glycoprotein antikoerper, Rh associated glycoprotein antikoerper, Rhesus blood group-associated A glycoprotein antikoerper, RHAG antikoerper, Rhag antikoerper
- Hintergrund
- The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kDa, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kDa, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.
- Molekulargewicht
- 45 kDa (MW of target protein)
-