STS Antikörper

Produktnummer ABIN630487

Produktdetails anti-STS Antikörper

Target: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: STS antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STS Blocking Peptide, catalog no. 33R-5135, is also available for use as a blocking control in assays to test for specificity of this STS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STS

Target: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Andere Bezeichnung: STS (STS Produkte)

Synonyme: ARSC antikoerper, ARSC1 antikoerper, ASC antikoerper, ES antikoerper, SSDD antikoerper, XLI antikoerper, abcg2 antikoerper, ArsC antikoerper, Sts antikoerper, si:ch211-271l9.1 antikoerper, steroid sulfatase antikoerper, breast cancer resistance protein antikoerper, Steryl-sulfatase antikoerper, steryl-sulfatase antikoerper, steroid sulfatase (microsomal), isozyme S antikoerper, STS antikoerper, abcg2 antikoerper, Sts antikoerper, Plav_0360 antikoerper, Psta_3963 antikoerper, Runsl_5106 antikoerper, LOC100712701 antikoerper, sts antikoerper

Hintergrund: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis