EMP2 Antikörper (Middle Region)
-
- Target Alle EMP2 Produkte
- EMP2 (Epithelial Membrane Protein 2 (EMP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EMP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- EMP2 antibody was raised against the middle region of EMP2
- Aufreinigung
- Purified
- Immunogen
- EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EMP2 Blocking Peptide, catalog no. 33R-4116, is also available for use as a blocking control in assays to test for specificity of this EMP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EMP2 (Epithelial Membrane Protein 2 (EMP2))
- Andere Bezeichnung
- EMP2 (EMP2 Produkte)
- Hintergrund
- Epithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognised as a putative tumor suppressor gene in certain model systems.
- Molekulargewicht
- 18 kDa (MW of target protein)
-