Retinoic Acid Receptor beta Antikörper (C-Term)

Produktnummer ABIN630489

Produktdetails anti-Retinoic Acid Receptor beta Antikörper

Target: Retinoic Acid Receptor beta (RARB) (Retinoic Acid Receptor, beta (RARB))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Retinoic Acid Receptor beta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RARB antibody was raised against the C terminal of RARB

Aufreinigung: Affinity purified

Immunogen: RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RARB Blocking Peptide, catalog no. 33R-8298, is also available for use as a blocking control in assays to test for specificity of this RARB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Retinoic Acid Receptor beta

Target: Retinoic Acid Receptor beta (RARB) (Retinoic Acid Receptor, beta (RARB))

Andere Bezeichnung: RARB (RARB Produkte)

Synonyme: RARB antikoerper, nRARs antikoerper, HAP antikoerper, NR1B2 antikoerper, RRB2 antikoerper, A830025K23 antikoerper, Hap antikoerper, Nr1b2 antikoerper, RARbeta2 antikoerper, RARBETA antikoerper, retinoic acid receptor beta antikoerper, retinoic acid receptor, beta antikoerper, RARB antikoerper, Rarb antikoerper

Hintergrund: RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway