Retinoid X Receptor beta Antikörper (N-Term)

Produktnummer ABIN630493

Produktdetails anti-Retinoid X Receptor beta Antikörper

Target: Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Retinoid X Receptor beta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RXRB antibody was raised against the N terminal of RXRB

Aufreinigung: Affinity purified

Immunogen: RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RXRB Blocking Peptide, catalog no. 33R-7103, is also available for use as a blocking control in assays to test for specificity of this RXRB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Retinoid X Receptor beta

Target: Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

Andere Bezeichnung: RXRB (RXRB Produkte)

Synonyme: DAUDI6 antikoerper, H-2RIIBP antikoerper, NR2B2 antikoerper, RCoR-1 antikoerper, RXR-beta antikoerper, RXRbeta antikoerper, rxrb antikoerper, RXRB antikoerper, nr2b2 antikoerper, daudi6 antikoerper, rcor-1 antikoerper, h-2riibp antikoerper, NR2B2-A antikoerper, RXR antikoerper, RXRA antikoerper, etID309733.19 antikoerper, rxre antikoerper, wu:fb93c09 antikoerper, AL023085 antikoerper, Nr2b2 antikoerper, Rub antikoerper, rxrd antikoerper, unp286 antikoerper, retinoid X receptor beta antikoerper, retinoid X receptor beta S homeolog antikoerper, retinoid x receptor, beta a antikoerper, retinoid x receptor, beta b antikoerper, RXRB antikoerper, Rxrb antikoerper, rxrb.S antikoerper, rxrb antikoerper, rxrba antikoerper, rxrbb antikoerper

Hintergrund: RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway