RORA Antikörper (N-Term)

Produktnummer ABIN630494

Produktdetails anti-RORA Antikörper

Target: RORA (RAR-Related Orphan Receptor A (RORA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RORA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RORA antibody was raised against the N terminal of RORA

Aufreinigung: Affinity purified

Immunogen: RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RORA Blocking Peptide, catalog no. 33R-9233, is also available for use as a blocking control in assays to test for specificity of this RORA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RORA

Target: RORA (RAR-Related Orphan Receptor A (RORA))

Andere Bezeichnung: RORA (RORA Produkte)

Synonyme: ror1 antikoerper, ror2 antikoerper, ror3 antikoerper, rzra antikoerper, nr1f1 antikoerper, MGC146531 antikoerper, NR1F1 antikoerper, ROR1 antikoerper, ROR2 antikoerper, ROR3 antikoerper, RZR-ALPHA antikoerper, RZRA antikoerper, RORalpha-B antikoerper, gb:dq017624 antikoerper, rora2 antikoerper, 9530021D13Rik antikoerper, Nr1f1 antikoerper, nmf267 antikoerper, sg antikoerper, staggerer antikoerper, tmgc26 antikoerper, RORalpha1 antikoerper, RAR related orphan receptor A antikoerper, RAR-related orphan receptor A antikoerper, RAR-related orphan receptor A, paralog a antikoerper, RAR-related orphan receptor alpha antikoerper, RORA antikoerper, rora antikoerper, Rora antikoerper, roraa antikoerper

Hintergrund: The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha