ESRRA Antikörper (N-Term)
-
- Target Alle ESRRA Antikörper anzeigen
- ESRRA (Estrogen-Related Receptor alpha (ESRRA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ESRRA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ESRRA antibody was raised against the N terminal of ESRRA
- Aufreinigung
- Affinity purified
- Immunogen
- ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN
- Top Product
- Discover our top product ESRRA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ESRRA Blocking Peptide, catalog no. 33R-4336, is also available for use as a blocking control in assays to test for specificity of this ESRRA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ESRRA (Estrogen-Related Receptor alpha (ESRRA))
- Andere Bezeichnung
- ESRRA (ESRRA Produkte)
- Hintergrund
- ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.
- Molekulargewicht
- 46 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha
-