HBS1L Antikörper

Produktnummer ABIN630516

Produktdetails anti-HBS1L Antikörper

Target: HBS1L (HBS1-Like (HBS1L))

Reaktivität: Hepatitis B Virus (HBV)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HBS1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HBS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HBS1L Blocking Peptide, catalog no. 33R-6246, is also available for use as a blocking control in assays to test for specificity of this HBS1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HBS1L

Target: HBS1L (HBS1-Like (HBS1L))

Abstract: HBS1L Produkte

Synonyme: EF-1a antikoerper, ERFS antikoerper, HBS1 antikoerper, HSPC276 antikoerper, 2810035F15Rik antikoerper, AI326327 antikoerper, eRFS antikoerper, wu:fc23c07 antikoerper, zgc:55400 antikoerper, EFL1-alpha antikoerper, chunp6927 antikoerper, eef1a antikoerper, ef1a antikoerper, ik:tdsubc_2a3 antikoerper, ik:tdsubc_2b3 antikoerper, tdsubc_2a3 antikoerper, wu:fa91c07 antikoerper, wu:fa94b03 antikoerper, wu:fi13b09 antikoerper, xx:tdsubc_2a3 antikoerper, xx:tdsubc_2b3 antikoerper, Hbs1l antikoerper, HBS1 like translational GTPase antikoerper, Hbs1-like (S. cerevisiae) antikoerper, HBS1-like translational GTPase antikoerper, elongation factor 1 alpha like protein antikoerper, HBS1-like (S. cerevisiae) antikoerper, eukaryotic translation elongation factor 1 alpha 1, like 1 antikoerper, HBS1 like translational GTPase L homeolog antikoerper, HBS1-like protein antikoerper, HBS1L antikoerper, Hbs1l antikoerper, hbs1l antikoerper, SJAG_02601 antikoerper, eef1a1l1 antikoerper, hbs1l.L antikoerper, LOC101787962 antikoerper

Substanzklasse: Viral Protein

Hintergrund: HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.

Molekulargewicht: 22 kDa (MW of target protein)