HBS1L Antikörper
-
- Target Alle HBS1L Antikörper anzeigen
- HBS1L (HBS1-Like (HBS1L))
-
Reaktivität
- Hepatitis B Virus (HBV)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HBS1L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HBS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH
- Top Product
- Discover our top product HBS1L Primärantikörper
-
anti-HBS1-Like (HBS1L) (AA 460-486) antibody
HBS1L Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB38809 unconjugated
anti-HBS1-Like (HBS1L) (AA 1-684) antibodyHBS1L Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-HBS1-Like (HBS1L) (AA 1-684) antibodyHBS1L Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-HBS1-Like (HBS1L) (N-Term) antibodyHBS1L Reaktivität: Human, Maus, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-HBS1-Like (HBS1L) (AA 1-260) antibodyHBS1L Reaktivität: Human, Affe WB Wirt: Maus Monoclonal 1F11 unconjugated
anti-HBS1-Like (HBS1L) (AA 1-242) antibodyHBS1L Reaktivität: Human, Affe WB Wirt: Maus Monoclonal 2A3 unconjugated
anti-HBS1-Like (HBS1L) (N-Term) antibodyHBS1L Reaktivität: Human, Maus, Affe, Kaninchen, Rind (Kuh), Zebrafisch (Danio rerio), Hund, Pferd, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-HBS1-Like (HBS1L) (AA 1-260) antibodyHBS1L Reaktivität: Human WB Wirt: Maus Monoclonal 1A7 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HBS1L Blocking Peptide, catalog no. 33R-6246, is also available for use as a blocking control in assays to test for specificity of this HBS1L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBS0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HBS1L (HBS1-Like (HBS1L))
- Abstract
- HBS1L Produkte
- Substanzklasse
- Viral Protein
- Hintergrund
- HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.
- Molekulargewicht
- 22 kDa (MW of target protein)
-
