DLC1 Antikörper (C-Term)

Produktnummer ABIN630519

Produktdetails anti-DLC1 Antikörper

Target: DLC1 (Deleted in Liver Cancer 1 (DLC1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DLC1 antibody was raised against the C terminal of DLC1

Aufreinigung: Affinity purified

Immunogen: DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLC1 Blocking Peptide, catalog no. 33R-6752, is also available for use as a blocking control in assays to test for specificity of this DLC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLC1

Target: DLC1 (Deleted in Liver Cancer 1 (DLC1))

Andere Bezeichnung: DLC1 (DLC1 Produkte)

Synonyme: ARHGAP7 antikoerper, HP antikoerper, STARD12 antikoerper, p122-RhoGAP antikoerper, rhogap7 antikoerper, DLC-1 antikoerper, StARD12 antikoerper, Dlc-1 antikoerper, A730069N07Rik antikoerper, Arhgap7 antikoerper, dlc-1 antikoerper, RhoGAP antikoerper, Dlc1 antikoerper, DLC1 Rho GTPase activating protein antikoerper, DLC1 Rho GTPase activating protein S homeolog antikoerper, rho GTPase-activating protein 7 antikoerper, deleted in liver cancer 1 antikoerper, DLC1 antikoerper, dlc1.S antikoerper, dlc1 antikoerper, LOC100456847 antikoerper, Dlc1 antikoerper, LOC100729904 antikoerper

Hintergrund: This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Tube Formation, Positive Regulation of Endopeptidase Activity