IL13RA2 Antikörper (N-Term)

Produktnummer ABIN630522

Produktdetails anti-IL13RA2 Antikörper

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL13RA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IL13 RA2 antibody was raised against the N terminal of IL13 A2

Aufreinigung: Affinity purified

Immunogen: IL13 RA2 antibody was raised using the N terminal of IL13 A2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL13RA2 Blocking Peptide, catalog no. 33R-1973, is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL13RA2

Target: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Andere Bezeichnung: IL13RA2 (IL13RA2 Produkte)

Synonyme: il-13ra2 antikoerper, sb:cb602 antikoerper, si:dkeyp-110c7.6 antikoerper, CD213A2 antikoerper, CT19 antikoerper, IL-13R antikoerper, IL13BP antikoerper, CD213a2 antikoerper, IL-13R-alpha-2 antikoerper, IL13RA2 antikoerper, interleukin 13 receptor, alpha 2 antikoerper, interleukin 13 receptor subunit alpha 2 antikoerper, interleukin 13 receptor subunit alpha 2 S homeolog antikoerper, il13ra2 antikoerper, IL13RA2 antikoerper, il13ra2.S antikoerper, Il13ra2 antikoerper

Hintergrund: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Molekulargewicht: 22 kDa (MW of target protein)