Septin 6 Antikörper (N-Term)

Produktnummer ABIN630523

Produktdetails anti-Septin 6 Antikörper

Target: Septin 6 (SEPT6)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Septin 6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Septin 6 antibody was raised against the N terminal of 40427

Aufreinigung: Affinity purified

Immunogen: Septin 6 antibody was raised using the N terminal of 40427 corresponding to a region with amino acids TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 38961 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Septin 6

Target: Septin 6 (SEPT6)

Andere Bezeichnung: Septin 6 (SEPT6 Produkte)

Synonyme: SEP2 antikoerper, SEPT2 antikoerper, sept11 antikoerper, SEPT11 antikoerper, 2810035H17Rik antikoerper, C920001C06Rik antikoerper, Sep6 antikoerper, mKIAA0128 antikoerper, Sep2 antikoerper, fc54b04 antikoerper, wu:fb70g05 antikoerper, wu:fc54b04 antikoerper, wu:fl76c07 antikoerper, zgc:66071 antikoerper, septin-6 antikoerper, septin 6 antikoerper, septin 6 L homeolog antikoerper, SEPT6 antikoerper, sept6.L antikoerper, Sept6 antikoerper, sept6 antikoerper, LOC100220762 antikoerper

Hintergrund: SEPT6 is a member of the septin family of GTPases. Members of this family are required for cytokinesis.

Molekulargewicht: 12 kDa (MW of target protein)