GBP4 Antikörper (Middle Region)
-
- Target Alle GBP4 Antikörper anzeigen
- GBP4 (Guanylate Binding Protein 4 (GBP4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GBP4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GBP4 antibody was raised against the middle region of GBP4
- Aufreinigung
- Affinity purified
- Immunogen
- GBP4 antibody was raised using the middle region of GBP4 corresponding to a region with amino acids NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE
- Top Product
- Discover our top product GBP4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GBP4 Blocking Peptide, catalog no. 33R-6647, is also available for use as a blocking control in assays to test for specificity of this GBP4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBP4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GBP4 (Guanylate Binding Protein 4 (GBP4))
- Andere Bezeichnung
- GBP4 (GBP4 Produkte)
- Synonyme
- AW228052 antikoerper, Mag-2 antikoerper, Mpa-2 antikoerper, Mpa2 antikoerper, mKIAA4245 antikoerper, Gbp3 antikoerper, MGC108424 antikoerper, GBP4 antikoerper, Gbp4 antikoerper, si:ch211-250m6.1 antikoerper, si:dkey-61p9.3 antikoerper, gbp4 antikoerper, gbp4.L antikoerper, mpa2 antikoerper, guanylate binding protein 4 antikoerper, guanylate-binding protein 4-like antikoerper, guanylate-binding protein 4 antikoerper, guanylate binding protein 4 S homeolog antikoerper, Gbp4 antikoerper, GBP4 antikoerper, gbp4 antikoerper, GBP4L antikoerper, LOC612426 antikoerper, LOC100713243 antikoerper, gbp4.S antikoerper
- Hintergrund
- GBP4 belongs to the GBP family. It binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently, GDP rather than GMP is the major reaction product. GBP4 plays a role in erythroid differentiation.
- Molekulargewicht
- 45 kDa (MW of target protein)
-