CCDC46 Antikörper (C-Term)
-
- Target Alle CCDC46 Antikörper anzeigen
- CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCDC46 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CCDC46 antibody was raised against the C terminal of CCDC46
- Aufreinigung
- Affinity purified
- Immunogen
- CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED
- Top Product
- Discover our top product CCDC46 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCDC46 Blocking Peptide, catalog no. 33R-3942, is also available for use as a blocking control in assays to test for specificity of this CCDC46 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC46 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))
- Andere Bezeichnung
- CCDC46 (CCDC46 Produkte)
- Synonyme
- CCDC46 antikoerper, MACOCO antikoerper, 1700001M19Rik antikoerper, 1700029K01Rik antikoerper, 8430407H02Rik antikoerper, AV043680 antikoerper, AV207351 antikoerper, Ccdc46 antikoerper, Macoco antikoerper, RGD1564168 antikoerper, centrosomal protein 112 antikoerper, centrosomal protein of 112 kDa antikoerper, CEP112 antikoerper, Cep112 antikoerper, LOC100523204 antikoerper, LOC100541423 antikoerper, cep112 antikoerper
- Hintergrund
- CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.
- Molekulargewicht
- 23 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-