SQLE Antikörper (C-Term)
-
- Target Alle SQLE Antikörper anzeigen
- SQLE (Squalene Epoxidase (SQLE))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SQLE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SQLE antibody was raised against the C terminal of SQLE
- Aufreinigung
- Affinity purified
- Immunogen
- SQLE antibody was raised using the C terminal of SQLE corresponding to a region with amino acids KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
- Top Product
- Discover our top product SQLE Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SQLE Blocking Peptide, catalog no. 33R-4493, is also available for use as a blocking control in assays to test for specificity of this SQLE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SQLE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SQLE (Squalene Epoxidase (SQLE))
- Andere Bezeichnung
- SQLE (SQLE Produkte)
- Hintergrund
- Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.
- Molekulargewicht
- 39 kDa (MW of target protein)
-