AGBL5 Antikörper (C-Term)

Produktnummer ABIN630529

Produktdetails anti-AGBL5 Antikörper

Target: AGBL5 (ATP/GTP Binding Protein-Like 5 (AGBL5))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGBL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AGBL5 antibody was raised against the C terminal of AGBL5

Aufreinigung: Affinity purified

Immunogen: AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AGBL5 Blocking Peptide, catalog no. 33R-6772, is also available for use as a blocking control in assays to test for specificity of this AGBL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGBL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGBL5

Target: AGBL5 (ATP/GTP Binding Protein-Like 5 (AGBL5))

Andere Bezeichnung: AGBL5 (AGBL5 Produkte)

Synonyme: zgc:91997 antikoerper, MGC83526 antikoerper, AGBL5 antikoerper, ccp5 antikoerper, 4930455N08 antikoerper, 9430057O19Rik antikoerper, CCP5 antikoerper, ATP/GTP binding protein-like 5 antikoerper, ATP/GTP binding protein-like 5 L homeolog antikoerper, ATP/GTP binding protein like 5 antikoerper, cytosolic carboxypeptidase-like protein 5 antikoerper, agbl5 antikoerper, agbl5.L antikoerper, AGBL5 antikoerper, LOC100181588 antikoerper, Agbl5 antikoerper

Hintergrund: AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown.

Molekulargewicht: 47 kDa (MW of target protein)