CC2D1B Antikörper (C-Term)
-
- Target Alle CC2D1B Antikörper anzeigen
- CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CC2D1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CC2 D2 antibody was raised against the C terminal of CC2 2
- Aufreinigung
- Affinity purified
- Immunogen
- CC2 D2 antibody was raised using the C terminal of CC2 2 corresponding to a region with amino acids IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF
- Top Product
- Discover our top product CC2D1B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CC2D1B Blocking Peptide, catalog no. 33R-4207, is also available for use as a blocking control in assays to test for specificity of this CC2D1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CC0 0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))
- Andere Bezeichnung
- CC2D1B (CC2D1B Produkte)
- Hintergrund
- CC2D1B belongs to the CC2D1 family. It contains 1 C2 domain. A function of Cc2d1b/Cc2d1a and their Drosophila homologue l(2)gd in D.melanogaster in Notch trafficking have been reported.
- Molekulargewicht
- 41 kDa (MW of target protein)
-