C18orf54 Antikörper
-
- Target Alle C18orf54 Antikörper anzeigen
- C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C18orf54 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- C18 ORF54 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN
- Top Product
- Discover our top product C18orf54 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C18ORF54 Blocking Peptide, catalog no. 33R-7000, is also available for use as a blocking control in assays to test for specificity of this C18ORF54 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C18orf54 (Chromosome 18 Open Reading Frame 54 (C18orf54))
- Andere Bezeichnung
- C18ORF54 (C18orf54 Produkte)
- Synonyme
- LAS2 antikoerper, 9930107F24 antikoerper, BB148262 antikoerper, Lars antikoerper, Las2 antikoerper, chromosome 18 open reading frame 54 antikoerper, RIKEN cDNA 4930503L19 gene antikoerper, c18orf54 antikoerper, C18orf54 antikoerper, 4930503L19Rik antikoerper
- Hintergrund
- The function of C18orf54 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 58 kDa (MW of target protein)
-